PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00055g05001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YB
Protein Properties Length: 226aa    MW: 25486.2 Da    PI: 6.7948
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00055g05001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB133.85.5e-4235130297
                     NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                               reqd +lPianv+rim+++lP++ak+s+dake vqe vs+fi  +t  a+++c++e+r+t++++d +wa+ ++G+ +yvepl++y
  Peinf101Scf00055g05001.1  35 REQDLYLPIANVTRIMRRILPQHAKVSDDAKEAVQELVSQFINHITIIANERCHNEQRRTVTAEDCIWAMNKIGLTNYVEPLTLY 119
                               89*********************************************************************************** PP

                     NF-YB  87 lkkyrelegek 97 
                               l++yre e+++
  Peinf101Scf00055g05001.1 120 LQRYREQESDR 130
                               ********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.7E-4331138IPR009072Histone-fold
SuperFamilySSF471135.48E-3337136IPR009072Histone-fold
PfamPF008087.1E-2040104IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-86886No hitNo description
PRINTSPR006151.4E-887105No hitNo description
PRINTSPR006151.4E-8106124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MERGHISNQQ RRNASSNYGS NNNGTGTLPN QQARREQDLY LPIANVTRIM RRILPQHAKV  60
SDDAKEAVQE LVSQFINHIT IIANERCHNE QRRTVTAEDC IWAMNKIGLT NYVEPLTLYL  120
QRYREQESDR SSGQRRPVHM SPNVELGLAP PTGSVQAFPL NYAPAQGYPY PQFHSFYDPA  180
VMMNGFNMNY GNEGMAENDE PAESSSSTGT NYGLSGVNDP FGQFRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A5e-3635125393NF-YB
4awl_B5e-3635125494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-3635125494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009784547.12e-98PREDICTED: nuclear transcription factor Y subunit B-6-like
SwissprotQ84W661e-44NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
SwissprotQ9SFD81e-44NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLE0ADH22e-49E0ADH2_9R
STRINGGLYMA07G39820.12e-45(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1624655
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.23e-46nuclear factor Y, subunit B6